PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026010P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 308aa    MW: 34573.4 Da    PI: 8.4574
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026010P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.2e-3270123255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH rFv+ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  MELO3C026010P1  70 PRLRWTPDLHLRFVHAVERLGGQENATPKLVLQLMNIKGLSIAHVKSHLQMYRS 123
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-2966124IPR009057Homeodomain-like
PROSITE profilePS5129412.79166126IPR017930Myb domain
SuperFamilySSF466894.12E-1569126IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2270125IPR006447Myb domain, plants
PfamPF002491.1E-971122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEVVGECSNT RSSDTDDNNN KKSESSSSST EFGNEGSSSN STIEENNNND HDQHKTKPPT  60
VRPYVRSKLP RLRWTPDLHL RFVHAVERLG GQENATPKLV LQLMNIKGLS IAHVKSHLQM  120
YRSKKTNEPG QVVGDQRVLM AESNNGDRNI FNVSQIPMFQ RYNSSYTSNL FRLGGSSWNA  180
IENNTIQSPF MEKSASLTTL TQARSSLFSS NKSNAPPGMI NRNPRTSISE SNMTTSKRQE  240
EREKEDPCSD IIPQKRKRAT DNGEIDLSLS LKIAPREEIK IEKRSIDQDE EVLASRTDLS  300
LSLCSYY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818840.0LN681884.1 Cucumis melo genomic scaffold, anchoredscaffold00086.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464217.10.0PREDICTED: probable transcription factor KAN3 isoform X1
RefseqXP_008464218.10.0PREDICTED: probable transcription factor KAN3 isoform X1
TrEMBLA0A0A0L1D10.0A0A0A0L1D1_CUCSA; Uncharacterized protein
STRINGPOPTR_0016s12940.12e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-51G2-like family protein